

Label artwork shown for GVL-VIP-10. Lot, manufacturing, and expiry values printed on the supplied label are lot-specific.
VIP
Vasoactive intestinal peptide is a 28-amino-acid neuropeptide studied in receptor binding and signal transduction research.
For laboratory research use only. Not for human or veterinary use.
Verified product data
Fields are shown only where the underlying record exists. Unverified attributes are omitted rather than estimated.
- SKU
- GVL-VIP-10
- Strength
- 10MG
- Research area
- Neuropeptide Research
- Format
- Lyophilized peptide, sealed vial
- CAS
- 37221-79-7
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Storage
Store at −20 °C, protected from light.
Laboratory handling
Handle in accordance with your institution's laboratory safety procedures for research chemicals.
Analytical records

Each unit ships with a printed GoVida Labs label carrying the product identity, strength, lot number, manufacturing date, and expiry for that specific lot. Match the lot number on your label to the register below to retrieve its analytical documentation.
No lot documentation is published for this product yet.
Records appear here once analytical documentation for a specific lot has been received and reviewed. We do not publish estimated or carried-over results. For the status of a lot you already hold, contact support with the lot number on the label.
Contact supportFor laboratory research use only. Not for human or veterinary use. These products are not medicines, supplements, or diagnostic tools, and are sold exclusively to qualified research customers.

